|
Antibody HPA025770
|
|
Antibody HPA025948
|
|
Antibody HPA027341
|
|
Antibody CAB017785
|
|
ANTIBODY INFORMATION
|
|
Provider |
Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | Atlas Antibodies Sigma-Aldrich
| | SDIX
| |
Product name |
HPA025770 | | HPA025948 | | HPA027341 | | 2488.00.02 | |
Host species |
Rabbit | | Rabbit | | Rabbit | | Rabbit | |
Clonality |
pAb | | pAb | | pAb | | msAb | |
Purity |
Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity purified using the PrEST-antigen as affinity ligand | | Affinity | |
Released in version |
6 | | 6 | | 6 | | 4 | |
ANTIGEN INFORMATION
|
|
Antigen |
Recombinant protein fragment | | Recombinant protein fragment | | Recombinant protein fragment | | Genetic immunization | |
Length (aa) |
80 | | 78 | | 96 | | | |
Antigen sequence |
DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKT
AHKNGSTLKETAIELGYLTAEQFDEWVKPK
| | KFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPE
NEPGSSIMPGKVNPTQCEAMTMVAAQVM
| | HFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKS
QSSNDTFPTAMHIAAAIEVHEVLLPGLQKLHDALDAKSKEFAQIIK
| |
| |
Matching transcripts |
FH-001 - ENSP00000355518 [100%]
| | FH-001 - ENSP00000355518 [100%]
| | FH-001 - ENSP00000355518 [100%]
| | | |
Other gene match |
| | | | | | | |
ANTIBODY VALIDATION
|
|
Mouse brain
|
|
Image |
| | | | | | | |
Description |
Positivity observed in cell bodies of subsets of neurons, most abundant in cortex and hippocampus. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Validation MB |
Uncertain | | | | | | | |
Immunohistochemistry
|
|
Image |
| | | | | | | |
Description |
Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells. More information | | Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubular cells. More information | | Immunohistochemical staining of human kidney shows strong cytoplasmic positivity with a granular pattern in tubular cells. More information | | Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity with a granular pattern in glandular cells. More information | |
Retrieval method |
HIER pH6 | | HIER pH6 | | HIER pH6 | | HIER pH6 | |
Antibody dilution |
1:500 | | 1:50 | | 1:1750 | | 1:500 | |
Literature conformity |
Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | | Consistent with extensive gene/protein characterization data | |
RNA consistency |
Not done | | Not done | | Not done | | Not done | |
Immunofluorescence
|
|
Image |
| | | | | | | |
Description |
Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Immunofluorescent staining of human cell line U-251 MG shows positivity in mitochondria. More information | |
Antibody dilution |
1:20 | | | | | | 1:125 | |
Validation IF |
Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | | | | | | Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. | |
siRNA
|
|
Image |
| | | | | | | |
Description |
Signal downregulation > 25% by one siRNA. More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Antibody dilution |
1:33 | | | | | | | |
Validation siRNA |
Supportive: The siRNA validation is supportive. | | | | | | | |
Western blot - siRNA
|
|
Image |
| | | | | | | |
Description |
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: siRNA 1 Lane 3: siRNA 2 Lane 4: Scrambled More information | | Application not done for this antibody. | | Application not done for this antibody. | | Application not done for this antibody. | |
Target mass (kDa) |
54.6 | | | | | | | |
Loading control |
Total protein image | | | | | | | |
Antibody dilution |
1:73 | | | | | | | |
Validation WB-siRNA |
Supportive: Downregulation visible in one of two siRNA lanes | | | | | | | |
Western Blot
|
|
Image |
| | | | | | | |
Description |
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400053) More information | | Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | | Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11 Lane 2: RT4 Lane 3: U-251 MG Lane 4: Human Plasma Lane 5: Liver Lane 6: Tonsil More information | |
Target mass (kDa) |
54.6 | | 54.6 | | 54.6 | | 54.6 | |
Antibody dilution |
1:250 | | 1:250 | | 1:250 | | 1:500 | |
Validation WB |
Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Supportive: Single band corresponding to the predicted size in kDa (+/-20%) | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | | Supportive: Band of predicted size in kDa (+/-20%) with additional bands present | |
Protein array
|
|
Image |
| | | | | | | |
Description |
Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green. More information | | Application not done for this antibody. | |
Antibody dilution |
1:3000 | | 1:500 | | 1:6000 | | | |
Validation PA |
Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | Supportive: Pass with single peak corresponding to interaction only with its own antigen. | | | |
|