AKAP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008620

 

Antibody HPA008691

 

Antibody CAB019286

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA008620 HPA008691 2785.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

14 3 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

141 141  

Antigen sequence

EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFI
ESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEE
GLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV
 
EHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFI
ESAHTELAKDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEE
GLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEATEQV
 
 

Matching transcripts

AKAP1-001 - ENSP00000337736 [100%]
AKAP1-003 - ENSP00000459968 [100%]
AKAP1-005 - ENSP00000459895 [100%]
AKAP1-006 - ENSP00000443139 [100%]
AKAP1-201 - ENSP00000314075 [100%]
AKAP1-202 - ENSP00000478212 [100%]
 AKAP1-001 - ENSP00000337736 [100%]
AKAP1-003 - ENSP00000459968 [100%]
AKAP1-005 - ENSP00000459895 [100%]
AKAP1-006 - ENSP00000443139 [100%]
AKAP1-201 - ENSP00000314075 [100%]
AKAP1-202 - ENSP00000478212 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:200 1:500 

Literature conformity

 Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line CACO-2 shows positivity in mitochondria.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 

Antibody dilution

1:97  1:125 

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody. 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY418643)
More information
  

Target mass (kDa)

97.3, 62.9 97.3, 62.9 97.3, 62.9, 21.8, 20.3, 20.0, 19.8, 15.1, 10.4, 9.2, 5.4, 1.0, 0.9 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AKAP1-001
 
AKAP1-003
 
AKAP1-005
 
AKAP1-006
 
AKAP1-201
 
AKAP1-202