ITPKA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040454

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040454 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

57 

Antigen sequence

DGSCSTDFKTTRSREQVLRVFEEFVQGDEEVLRRYLNRLQQIRDTLEVSE
FFRRHEV
 

Matching transcripts

ITPKA-001 - ENSP00000260386 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Mouse brain

Image

 

Description

Staining observed in subsets of astrocytes, most abundant in hippocampus and subiculum. End feet positivity was seen as accentuation to blood vessel walls.
More information
 

Validation MB

Uncertain 

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in astrocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:3500 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 

Antibody dilution

1:122 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

51.0 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ITPKA-001