AKAP6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048741

 

Antibody CAB001983

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA048741 07-087 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

13 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

140  

Antigen sequence

SHSATKSALIQKLMQDIQHQDNYEAIWEKIEGFVNKLDEFIQWLNEAMET
TENWTPPKAEMDDLKLYLETHLSFKLNVDSHCALKEAVEEEGHQLLELIA
SHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKA
 
 

Matching transcripts

AKAP6-001 - ENSP00000280979 [100%]
AKAP6-002 - ENSP00000450531 [100%]
AKAP6-004 - ENSP00000451247 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows moderate nuclear membranous positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows moderate nuclear membrane positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:350 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

256.7, 139.6, 120.2 256.7, 139.6, 120.2, 38.5, 13.8, 12.3, 5.2, 3.0 

Antibody dilution

1:1510 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:12100  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
AKAP6-001
 
AKAP6-002
 
AKAP6-004