GHRL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014246

 

Antibody CAB022731

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA014246 AB9894 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

58  

Antigen sequence

RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLS
GVQYQQHS
 
 

Matching transcripts

GHRL-001 - ENSP00000335074 [100%]
GHRL-003 - ENSP00000388145 [100%]
GHRL-004 - ENSP00000416768 [100%]
GHRL-005 - ENSP00000414819 [100%]
GHRL-006 - ENSP00000399922 [100%]
GHRL-008 - ENSP00000287656 [100%]
GHRL-009 - ENSP00000391406 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:500 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNA expression data Consistent with RNA expression data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402547)
More information
  

Target mass (kDa)

12.9, 12.8, 11.8, 11.7 12.9, 12.8, 11.8, 11.7, 10.0, 7.5, 4.5, 3.5 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
GHRL-001
 
GHRL-003
 
GHRL-004
 
GHRL-005
 
GHRL-006
 
GHRL-008
 
GHRL-009