SMAD4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019154

 

Antibody CAB002312

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA019154 NCL-DPC4 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

123  

Antigen sequence

AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFE
GQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNI
PVASTSQPASILGGSHSEGLLQI
 
 

Matching transcripts

SMAD4-001 - ENSP00000381452 [100%]
SMAD4-201 - ENSP00000341551 [100%]
SMAD4-004 - ENSP00000464901 [85%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human rectum shows strong positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows cytoplasmic positivity, with a granular pattern, in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:20 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNA expression data Mainly not consistent with RNA expression data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

60.4, 50.1 60.4, 50.1, 17.0, 15.9, 14.3, 13.7, 9.9, 8.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SMAD4-001
 
SMAD4-004
 
SMAD4-201