ACSF3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008322

 

Antibody HPA008323

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA008322 HPA008323 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

144 148 

Antigen sequence

ATCVMMPEFSPQQVWEKFLSSETPRINVFMAVPTIYTKLMEYYDRHFTQP
HAQDFLRAVCEEKIRLMVSGSAALPLPVLEKWKNITGHTLLERYGMTEIG
MALSGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHA
 
VARSDRSAPVFTRALAFGDRIALVDQHGRHTYRELYSRSLRLSQEICRLC
GCVGGDLREERVSFLCANDASYVVAQWASWMSGGVAVPLYRKHPAAQLEY
VICDSQSSVVLASQEYLELLSPVVRKLGVPLLPLTPAIYTGAVEEPAE
 

Matching transcripts

ACSF3-001 - ENSP00000320646 [100%]
ACSF3-003 - ENSP00000384627 [100%]
ACSF3-014 - ENSP00000442683 [100%]
ACSF3-201 - ENSP00000479130 [100%]
ACSF3-002 - ENSP00000367596 [97%]
ACSF3-010 - ENSP00000445397 [97%]
ACSF3-012 - ENSP00000442781 [97%]
 ACSF3-001 - ENSP00000320646 [100%]
ACSF3-003 - ENSP00000384627 [100%]
ACSF3-009 - ENSP00000440734 [100%]
ACSF3-201 - ENSP00000479130 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:35 

Literature conformity

Partly consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Not done Mainly consistent with RNA expression data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.1, 35.1, 26.6, 21.5, 20.3 64.1, 26.0 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ACSF3-001
 
ACSF3-002
 
ACSF3-003
 
ACSF3-009
 
ACSF3-010
 
ACSF3-012
 
ACSF3-014
 
ACSF3-201