AC240274.1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038748

 

Antibody HPA038752

 

Antibody HPA042595

 

Antibody HPA043105

 

Antibody HPA043692

 

Antibody HPA044023

 

Antibody HPA046888

 

Antibody HPA046971

 

Antibody HPA058050

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038748 HPA038752 HPA042595 HPA043105 HPA043692 HPA044023 HPA046888 HPA046971 HPA058050 

Host species

Rabbit Rabbit Rabbit Rabbit Rabbit Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb pAb pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 13 13 13 13 13 14 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

25 25 25 25 31 29 25 30 25 

Antigen sequence

EEDKVNSSLVVDRESSHDGCQDALN
 
MFSNSTGRLPGQPTEEIQQYKVLVH
 
GPVSPRNLQESEEEEVPQESWDEGY
 
SGCLELTDSCQPYRSAFYVLEQQRV
 
QPDSCQPYGSSFYALEEKHVGFSLDVGEIEK
 
VDIGRHRWDQVKKEDQEATGPRLSRELLD
 
MVVSAGPLSSEKAEMNILEINEKLR
 
RELLDEKEPEVLQDSLDRCYSTPSGYLELP
 
MVVSAGPLSSEKAEMNILEINEKLR
 

Matching transcripts

AC240274.1-204 - ENSP00000480818 [88%]
 AC240274.1-204 - ENSP00000480818 [96%]
 AC240274.1-201 - ENSP00000484923 [100%]
AC240274.1-202 - ENSP00000478665 [100%]
AC240274.1-204 - ENSP00000480818 [100%]
 AC240274.1-201 - ENSP00000484923 [92%]
AC240274.1-202 - ENSP00000478665 [92%]
AC240274.1-204 - ENSP00000480818 [92%]
 AC240274.1-201 - ENSP00000484923 [97%]
AC240274.1-202 - ENSP00000478665 [97%]
 AC240274.1-201 - ENSP00000484923 [97%]
AC240274.1-202 - ENSP00000478665 [97%]
AC240274.1-204 - ENSP00000480818 [97%]
 AC240274.1-203 - ENSP00000478612 [96%]
AC240274.1-204 - ENSP00000480818 [96%]
AC240274.1-202 - ENSP00000478665 [92%]
 AC240274.1-201 - ENSP00000484923 [100%]
AC240274.1-202 - ENSP00000478665 [100%]
AC240274.1-204 - ENSP00000480818 [100%]
 AC240274.1-203 - ENSP00000478612 [96%]
AC240274.1-204 - ENSP00000480818 [96%]
AC240274.1-202 - ENSP00000478665 [92%]
 

Other gene match

NBPF1 - ENSG00000219481 [88%]
NBPF11 - ENSG00000263956 [100%]
NBPF12 - ENSG00000268043 [96%]
NBPF9 - ENSG00000269713 [88%]
NBPF14 - ENSG00000270629 [88%]
NBPF10 - ENSG00000271425 [88%]
CH17-3B23.1 - ENSG00000273136 [88%]
 NBPF11 - ENSG00000263956 [100%]
NBPF14 - ENSG00000270629 [100%]
NBPF10 - ENSG00000271425 [100%]
CH17-3B23.1 - ENSG00000273136 [100%]
 NBPF3 - ENSG00000142794 [92%]
NBPF8 - ENSG00000162825 [100%]
NBPF1 - ENSG00000219481 [100%]
NBPF11 - ENSG00000263956 [100%]
NBPF15 - ENSG00000266338 [100%]
NBPF12 - ENSG00000268043 [100%]
NBPF9 - ENSG00000269713 [100%]
NBPF14 - ENSG00000270629 [100%]
NBPF14 - ENSG00000271383 [100%]
NBPF10 - ENSG00000271425 [100%]
CH17-3B23.1 - ENSG00000273136 [100%]
 NBPF8 - ENSG00000162825 [100%]
NBPF1 - ENSG00000219481 [92%]
NBPF11 - ENSG00000263956 [80%]
NBPF15 - ENSG00000266338 [100%]
NBPF12 - ENSG00000268043 [84%]
NBPF9 - ENSG00000269713 [100%]
NBPF14 - ENSG00000270629 [100%]
NBPF14 - ENSG00000271383 [100%]
NBPF10 - ENSG00000271425 [100%]
CH17-3B23.1 - ENSG00000273136 [100%]
 NBPF3 - ENSG00000142794 [84%]
NBPF8 - ENSG00000162825 [100%]
NBPF1 - ENSG00000219481 [97%]
NBPF11 - ENSG00000263956 [100%]
NBPF15 - ENSG00000266338 [100%]
NBPF12 - ENSG00000268043 [97%]
NBPF9 - ENSG00000269713 [100%]
NBPF14 - ENSG00000270629 [100%]
NBPF14 - ENSG00000271383 [100%]
NBPF10 - ENSG00000271425 [100%]
CH17-3B23.1 - ENSG00000273136 [100%]
 NBPF3 - ENSG00000142794 [86%]
NBPF8 - ENSG00000162825 [100%]
NBPF1 - ENSG00000219481 [97%]
NBPF11 - ENSG00000263956 [100%]
NBPF15 - ENSG00000266338 [100%]
NBPF12 - ENSG00000268043 [97%]
NBPF9 - ENSG00000269713 [100%]
NBPF14 - ENSG00000270629 [100%]
NBPF14 - ENSG00000271383 [100%]
NBPF10 - ENSG00000271425 [100%]
CH17-3B23.1 - ENSG00000273136 [97%]
 NBPF3 - ENSG00000142794 [84%]
NBPF8 - ENSG00000162825 [96%]
NBPF6 - ENSG00000186086 [84%]
NBPF4 - ENSG00000196427 [84%]
NBPF1 - ENSG00000219481 [96%]
NBPF11 - ENSG00000263956 [96%]
NBPF15 - ENSG00000266338 [100%]
NBPF12 - ENSG00000268043 [100%]
NBPF9 - ENSG00000269713 [100%]
NBPF14 - ENSG00000270629 [100%]
NBPF14 - ENSG00000271383 [92%]
NBPF10 - ENSG00000271425 [100%]
CH17-3B23.1 - ENSG00000273136 [92%]
 NBPF3 - ENSG00000142794 [90%]
NBPF8 - ENSG00000162825 [100%]
NBPF1 - ENSG00000219481 [93%]
NBPF11 - ENSG00000263956 [97%]
NBPF15 - ENSG00000266338 [97%]
NBPF12 - ENSG00000268043 [97%]
NBPF9 - ENSG00000269713 [100%]
NBPF14 - ENSG00000270629 [100%]
NBPF14 - ENSG00000271383 [100%]
NBPF10 - ENSG00000271425 [100%]
CH17-3B23.1 - ENSG00000273136 [97%]
 NBPF3 - ENSG00000142794 [84%]
NBPF8 - ENSG00000162825 [96%]
NBPF6 - ENSG00000186086 [84%]
NBPF4 - ENSG00000196427 [84%]
NBPF1 - ENSG00000219481 [96%]
NBPF11 - ENSG00000263956 [96%]
NBPF15 - ENSG00000266338 [100%]
NBPF12 - ENSG00000268043 [100%]
NBPF9 - ENSG00000269713 [100%]
NBPF14 - ENSG00000270629 [100%]
NBPF14 - ENSG00000271383 [92%]
NBPF10 - ENSG00000271425 [100%]
CH17-3B23.1 - ENSG00000273136 [92%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

         

Description

Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach, lower shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human uterus, post-menopause shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
More information
 Application not done for this antibody. Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
More information
 Immunohistochemical staining of human testis shows strong dot like positivity in subset of cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6  HIER pH6 HIER pH6 

Antibody dilution

1:500 1:50 1:1300 1:300 1:1700 1:500  1:35 1:150 

Literature conformity

No avaliable gene/protein characterization data No avaliable gene/protein characterization data No avaliable gene/protein characterization data No avaliable gene/protein characterization data No avaliable gene/protein characterization data No avaliable gene/protein characterization data  No avaliable gene/protein characterization data No avaliable gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data Not consistent with RNA expression data Not consistent with RNA expression data Not consistent with RNA expression data Not consistent with RNA expression data Mainly not consistent with RNA expression data  Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

         

Description

Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
 Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

   1:76   1:62   

Validation IF

   Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.   Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.   

         Western Blot

Image

         

Description

   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

428.6, 343.2, 323.9, 167.7, 139.5, 136.2, 130.6, 128, 127.8, 125.7, 113.1, 108.7, 108.6, 108.4, 108.3, 100.1, 100, 99.8, 99.7, 99.5, 99.4, 94.9, 90.5, 88.2, 60.7, 60.6, 60.4 94.9, 90.5, 88.2, 60.7, 60.6, 60.4 646.1, 440.4, 428.6, 343.2, 323.9, 167.7, 139.5, 136.2, 130.6, 128, 127.8, 125.7, 113.1, 108.7, 108.6, 108.4, 108.3, 106.1, 106, 105.9, 105.8, 100.1, 100, 99.8, 99.7, 99.5, 99.4, 94.9, 90.5, 88.2, 77.6, 73, 69.5, 69.4, 67.1, 66.9, 66.8, 65.1 646.1, 595.7, 440.4, 428.6, 343.2, 323.9, 167.7, 139.5, 136.2, 130.6, 128, 127.8, 125.7, 113.1, 108.7, 108.6, 108.4, 108.3, 106.1, 106, 105.9, 105.8, 99.5, 99.4, 94.9, 90.5, 88.2, 77.6, 69.5, 69.4, 29.6, 26.7 646.1, 595.7, 440.4, 428.6, 343.2, 323.9, 167.7, 139.5, 136.2, 130.6, 128, 127.8, 125.7, 113.1, 108.7, 108.6, 108.4, 108.3, 106.1, 106, 105.9, 105.8, 100.1, 100, 99.8, 99.7, 77.6, 73, 71.6, 69.5, 69.4, 67.1, 66.9, 66.8, 65.1, 31, 29.6, 26.7 646.1, 440.4, 428.6, 343.2, 323.9, 167.7, 139.5, 136.2, 130.6, 128, 127.8, 125.7, 113.1, 108.7, 108.6, 108.4, 108.3, 106.1, 106, 105.9, 105.8, 100.1, 100, 99.8, 99.7, 99.5, 99.4, 94.9, 90.5, 88.2, 77.6, 73, 69.5, 69.4, 67.1, 66.9, 66.8, 65.1 646.1, 440.4, 428.6, 343.2, 323.9, 167.7, 139.5, 136.2, 130.6, 128, 127.8, 125.7, 113.1, 108.7, 108.6, 108.4, 108.3, 100.1, 100, 99.8, 99.7, 99.5, 99.4, 94.9, 90.5, 88.2, 77.6, 75.4, 75.2, 73, 72.2, 72.1, 71.6, 67.1, 66.9, 66.8, 64.8, 60.7, 60.6, 60.4, 34.2, 34.1, 34, 9.2 646.1, 595.7, 440.4, 428.6, 343.2, 323.9, 167.7, 139.5, 136.2, 130.6, 128, 127.8, 125.7, 113.1, 108.7, 108.6, 108.4, 108.3, 106.1, 106, 105.9, 105.8, 100.1, 100, 99.8, 99.7, 99.5, 99.4, 94.9, 90.5, 88.2, 77.6, 73, 71.6, 69.5, 69.4, 67.1, 66.9, 66.8, 65.1, 31, 29.6, 26.7 646.1, 440.4, 428.6, 343.2, 323.9, 167.7, 139.5, 136.2, 130.6, 128, 127.8, 125.7, 113.1, 108.7, 108.6, 108.4, 108.3, 100.1, 100, 99.8, 99.7, 99.5, 99.4, 94.9, 90.5, 88.2, 77.6, 75.4, 75.2, 73, 72.2, 72.1, 71.6, 67.1, 66.9, 66.8, 64.8, 60.7, 60.6, 60.4, 34.2, 34.1, 34, 9.2 

Antibody dilution

1:250 1:250 1:250 1:250 1:250 1:250 1:310 1:130 1:190 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

         

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:3000 1:6000 1:3000 1:3000 1:3000 1:2500 1:1050 1:2300 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AC240274.1-201
 
AC240274.1-202
 
AC240274.1-203
 
AC240274.1-204